PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr7g109870.2
Common NameMTR_7g109870
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family MYB_related
Protein Properties Length: 434aa    MW: 49081.9 Da    PI: 9.7449
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr7g109870.2genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding22.82.2e-07131173447
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      WT+eE   l d+++++  + +  Ia +++  Rt +++k+r++++
  Medtr7g109870.2 131 WTKEETNELFDLCERFDLR-FVVIADRFPSSRTVEELKDRYYSV 173
                      *******************.*********************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF162824.4E-30103177IPR032563DAMP1, SANT/Myb-like domain
SuperFamilySSF466896.93E-7127178IPR009057Homeodomain-like
SMARTSM007171.3E-8127176IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-6130175IPR009057Homeodomain-like
CDDcd116583.15E-18131173No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0032259Biological Processmethylation
GO:0000812Cellular ComponentSwr1 complex
GO:0035267Cellular ComponentNuA4 histone acetyltransferase complex
GO:0003677Molecular FunctionDNA binding
GO:0008168Molecular Functionmethyltransferase activity
Sequence ? help Back to Top
Protein Sequence    Length: 434 aa     Download sequence    Send to blast
MDAKDILGLH KNSFPSSLDN KKSRPPKESQ RKPDGISREV YALTGGMPPL MPSIDASQLK  60
KKPPTHEKVT WQWLPFTNSA RKDDLHLYHW VRVVNGVLPT GDYSFAKYNK SVDIIKYTDE  120
EYEKYLTDPM WTKEETNELF DLCERFDLRF VVIADRFPSS RTVEELKDRY YSVLRAILLA  180
RAASSGDIAT HPIIKEPYNV SQEMERKRAL SMVLSQTRQQ EKRDEEVLIE AKRIAELRMA  240
SKVTEQSQLA VASNADAELT ERAVPGETVS PSNVQLPQMV VPSADNASTL ASLRMLRVYL  300
RTYALEQMVQ ASNATAGVRT IKRVEQTLQD LGVNLKPRVP TKAVCAEHLE LRREILTWLN  360
LQKQVQYKEA EGSSFRDGSY GETPGTPKDR TFIPDSLNFG GERVGKKDQK RKGHGAPPTA  420
AHKRPRKQKA SDL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3hm5_A4e-21102187493DNA methyltransferase 1-associated protein 1
4iej_A4e-21102187493DNA methyltransferase 1-associated protein 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.121440.0glandular trichome| leaf| pod| root| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003626001.10.0DNA methyltransferase 1-associated protein
SwissprotQ8VZL60.0SWC4_ARATH; SWR1-complex protein 4
TrEMBLG7KTN90.0G7KTN9_MEDTR; DNA methyltransferase 1-associated protein
STRINGGLYMA19G40630.10.0(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47210.10.0MYB_related family protein
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]